DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Sec14l2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:237 Identity:50/237 - (21%)
Similarity:107/237 - (45%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTN-KWRETYGVD 68
            :|:|..|:.....:|.::.::.|.|..  :|:.|.|:|||........:|:|:.: ::|:...:|
  Rat     7 DLSPKQEEALAKFRENVQDVLPALPNP--DDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDID 69

  Fly    69 KLSEMDRSQLDKKARLLRHR---DCIGRPVIY-----IPAKNHSSERDIDELTRFIVYNLEEACK 125
            |:......::.:: .|...|   |..|.||.|     :.||.........:|.|..:.:.|...:
  Rat    70 KIISWQPPEVIQQ-YLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQ 133

  Fly   126 KCFEEVT------DRLCIVFDLAEFSTSCMDYQLVQ---NLIWLLGKHFPERLGVCLIINSPGLF 181
            :|..:..      :.:.:::|........:....|:   ..:.:..:::||.|....::.:|.||
  Rat   134 ECTHQTAKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLF 198

  Fly   182 STIWPAIRVLLDDNTAKKVKFV-ADEAE-LCQYLIPDILPTD 221
            ...:..|:..|.::|.||:..: |:..| |.:::.||.||.:
  Rat   199 PVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/152 (20%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 12/47 (26%)
SEC14 76..244 CDD:214706 33/166 (20%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.