DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and LOC110439320

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_021330480.1 Gene:LOC110439320 / 110439320 -ID:- Length:230 Species:Danio rerio


Alignment Length:164 Identity:31/164 - (18%)
Similarity:57/164 - (34%) Gaps:52/164 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FKTTDDAFQAILKTNKWRETYGVDKLSEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDI 109
            ::|.::.....:|.  |.||             :.|.|.:|:     |.|        |....:|
Zfish    21 YRTAEELENEEVKL--WNET-------------IYKSASVLK-----GAP--------HEVLIEI 57

  Fly   110 DELTRFIVYNLEEACKKCFEEVTDRLCIVF------------DLAEFSTSCMDYQLVQ--NLIWL 160
            .:::..|.::. :.||      .|.:..::            .|:..:.:|.....||  :..|:
Zfish    58 TDVSSVITWDF-DVCK------GDMIFNIYHSRRAPQPVKKEGLSAHNLACPAGNNVQFIDRSWM 115

  Fly   161 LGKHFP--ERLGVCLIINS-PGLFSTIWPAIRVL 191
            ||:.:.  |....|....| .|...|.||...:|
Zfish   116 LGQDYSMVETALTCREGESVQGSHVTRWPGFYIL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 24/124 (19%)
LOC110439320XP_021330480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.