DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and si:dkey-237i9.1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_021332743.1 Gene:si:dkey-237i9.1 / 100535835 ZFINID:ZDB-GENE-060503-441 Length:719 Species:Danio rerio


Alignment Length:247 Identity:58/247 - (23%)
Similarity:104/247 - (42%) Gaps:44/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVD 68
            :|.|:.|.....|:..::   |....:...|..:.|:|||.. ..|.|.:.:.::..||:.:.||
Zfish   254 DLTPLQESCLIRLRHWLQ---ETHKGKIPKDEHILRFLRARDFNIDKAREILCQSLTWRKQHQVD 315

  Fly    69 KLSEMDRSQLD--KKARLL--------RHRDCIGRPVIYIPAKNHSSERDI------DELTRFIV 117
            .|       ||  ...::|        .|.|..||| :||....|...:.:      :.|.|.::
Zfish   316 YL-------LDTWSSPQVLHDFYTGGWHHHDNDGRP-LYILRLGHMDTKGLVRALGEESLLRHVL 372

  Fly   118 YNLEEACKKCFEE-------VTDRLCIVFDLAEFSTSCMDYQLVQ---NLIWLLGKHFPERLGVC 172
            ...||..::|.|.       ::...|:| ||...:...:....|:   .:|.::..::||.||..
Zfish   373 SINEEGLRRCEENTKVFGRPISCWTCLV-DLEGLNMRHLWRPAVKALLRIIEVVEANYPETLGRL 436

  Fly   173 LIINSPGLFSTIWPAIRVLLDDNTAKKVKFVA-----DEAELCQYLIPDILP 219
            ||:.:|.:|..:|..:...:|:||.||....|     ....|..|:..:::|
Zfish   437 LILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGSGGLVDYIDKEVIP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 38/162 (23%)
si:dkey-237i9.1XP_021332743.1 PRELI 17..173 CDD:309720
CRAL_TRIO_N 260..305 CDD:215024 10/47 (21%)
CRAL_TRIO 331..494 CDD:306996 38/160 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.