DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and si:ch73-206p6.1

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002666647.1 Gene:si:ch73-206p6.1 / 571998 ZFINID:ZDB-GENE-030131-5048 Length:230 Species:Danio rerio


Alignment Length:226 Identity:109/226 - (48%)
Similarity:156/226 - (69%) Gaps:2/226 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PENWMSIP-VGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEE 101
            |.|...:| .|:|.||.||||||.:||||:.||:|.:|.|.|||:.|:::::|||||||::|.||
Zfish     3 PMNMYMVPNPGIPGCPPGLEYLTQVDQLLIKQKVELIEALAGFESNNKYEIRNSLGQNVFYAVEE 67

  Fly   102 SDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQV 166
            :||.||...|..|.|.:::||||..|::.:.||.|| :.|.||.|:..:|:.:|||..:|.|.|.
Zfish    68 NDCLTRQCCGPLRSFTIRVLDNFGQEIITVNRPLKC-MSCFFPCCLQELEIQSPPGNTVGYVVQQ 131

  Fly   167 CTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSDTNFKVLSANNEEIGKISKQWSGLGRELFTDAD 231
            .....|||.|:|.....||:::||.|...|..|.:|::|:.:...||||||||:||.||:|||:|
Zfish   132 WHPFLPKFTIENEHRQPVLKLQGPFCGWSCLPDVDFEILTMDEVSIGKISKQWTGLLREVFTDSD 196

  Fly   232 YFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262
            .|.:.||::|||||||::..|.||||.:::|
Zfish   197 NFGIQFPMDLDVRMKAVMIGACFLIDFMFFE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 107/222 (48%)
si:ch73-206p6.1XP_002666647.1 Scramblase 10..227 CDD:252175 106/217 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.