DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and plscr3a

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001098583.1 Gene:plscr3a / 564882 ZFINID:ZDB-GENE-060531-17 Length:234 Species:Danio rerio


Alignment Length:212 Identity:105/212 - (49%)
Similarity:149/212 - (70%) Gaps:1/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPF 116
            |.||||||.:||:||.||||.||.:.||||.|::::|||:||.::.|.|.:||||||:.|..|.|
Zfish    12 PPGLEYLTQIDQILVHQKIELLEAIIGFETNNQYEIKNSMGQKIFHAKENTDCCTRNICGPLRSF 76

  Fly   117 EMKILDNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCG 181
            |::|.|||:.||:||.||::| ..||||.|:..:||.||||..||.::|.....:|.|::.:...
Zfish    77 EIEIRDNFEQEVIHLSRPYRC-TSCCFPCCLQELEVQAPPGNPIGYIKQDWHMFKPMFSLYDMSK 140

  Fly   182 DTVLQIEGPVCPCKCFSDTNFKVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMK 246
            ..:|.||||:|...|..|.:|.||..:...:|:|||||:||.:|..||:|.|.:.||::|||:||
Zfish   141 TKMLTIEGPLCAVSCCGDVDFDVLGKDGNPVGRISKQWAGLIKESLTDSDNFGINFPIDLDVKMK 205

  Fly   247 ALIFAALFLIDAVYYEQ 263
            |::..|.||||.:::||
Zfish   206 AVLLGACFLIDFMFFEQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 103/210 (49%)
plscr3aNP_001098583.1 Scramblase 1..222 CDD:252175 103/210 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.