DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and plscr3

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001011298.1 Gene:plscr3 / 496751 XenbaseID:XB-GENE-6449810 Length:296 Species:Xenopus tropicalis


Alignment Length:221 Identity:87/221 - (39%)
Similarity:133/221 - (60%) Gaps:2/221 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRN 108
            :||.....|.|||||:.:||:|:.||.|.||.:|||||.|::::.:.:|:.:....|.|..|.|.
 Frog    65 LPVSGGTAPSGLEYLSQIDQILIHQKTEVLEAVTGFETCNQYELLSIMGEKILSVQERSSLCARC 129

  Fly   109 MLGRSRPFEMKILDNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPK 173
            ..|..||..:::.|....|::|..||.|| ..||||.|:..:||.:|||..:|.|.|......||
 Frog   130 CCGSLRPLTLQLCDPSGRELIHFIRPLKC-TSCCFPCCLQELEVQSPPGHTVGYVVQSWHPFIPK 193

  Fly   174 FNIKNTCGDTVLQIEGPVCPCKCFSDTNFKVLS-ANNEEIGKISKQWSGLGRELFTDADYFSVTF 237
            :::.....:.||::.||.....|..|.:|:|.. ..:..:|:|||.|.||.:|:|||||.|.:.|
 Frog   194 YSLLTETREPVLKVVGPCIMSSCCGDIDFQVKPLCESRSVGRISKHWGGLAKEIFTDADNFGIQF 258

  Fly   238 PLNLDVRMKALIFAALFLIDAVYYEQ 263
            |.::||:|||::..|.||:|.|::|:
 Frog   259 PKDIDVKMKAVLLGACFLLDYVFFER 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 86/219 (39%)
plscr3NP_001011298.1 Scramblase 47..284 CDD:252175 86/219 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.