DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and plscr3b

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_998031.1 Gene:plscr3b / 405802 ZFINID:ZDB-GENE-040426-2517 Length:314 Species:Danio rerio


Alignment Length:272 Identity:115/272 - (42%)
Similarity:162/272 - (59%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QNAP-----------QDENGAVVLQPQAANVGNNANGPENWMSIPVGMP-------NCPQGLEYL 58
            ||||           .|:  .::.||...:.|.....|   ..:|..:|       ..|.|||||
Zfish    37 QNAPPAGFQVGYQPVPDQ--PIMYQPGPVSPGPQPGQP---YGVPAAVPAPIAVPAGVPPGLEYL 96

  Fly    59 TALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDN 123
            |.:||:|:.||:|.||...||||.|::::||||||.:|.|.|::||||||..|..|.|:|||.||
Zfish    97 TQIDQILIHQKVELLEAFIGFETNNQYEIKNSLGQKIYSAKEKNDCCTRNCCGALRSFDMKIKDN 161

  Fly   124 FQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIE 188
            ...||:.|.||::| :.|..|.|:..:|:.||||..||.|:|......|||:|.....:||:::|
Zfish   162 MDREVIRLIRPYRC-VSCWCPCCLQEMEIQAPPGTPIGYVKQDWHPCYPKFSIMGPNKETVMKLE 225

  Fly   189 GPVCPCKCFSDTNF--KVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFA 251
            ||...|.|..|.:|  |......:.||:|||||:||.:|:|||||.|.:.|||::||:|||::..
Zfish   226 GPCMACNCCGDVHFELKGKDGTGKPIGRISKQWTGLLKEVFTDADNFGIQFPLDMDVKMKAVLMG 290

  Fly   252 ALFLIDAVYYEQ 263
            ..||||.:::|:
Zfish   291 TCFLIDFMFFEK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 105/229 (46%)
plscr3bNP_998031.1 RRM <4..94 CDD:330708 13/61 (21%)
Scramblase 80..302 CDD:252175 104/222 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.