DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and PLSCR5

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_016861862.1 Gene:PLSCR5 / 389158 HGNCID:19952 Length:300 Species:Homo sapiens


Alignment Length:260 Identity:101/260 - (38%)
Similarity:151/260 - (58%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPQNAPQDENGAVVLQPQAANVGNNANGPENW-MSIPVG---MP--NCPQGLEYLTALDQLLVSQ 68
            || .||..:...    |.::|.||.|     | :|:|:.   :|  :.|.|||||:.||.:::.|
Human    17 LP-GAPDPDQSL----PASSNPGNQA-----WQLSLPLPSSFLPTVSLPPGLEYLSQLDLIIIHQ 71

  Fly    69 KIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYR 133
            ::|.|.::.|.||.|::::||||||.:|||.|||.|..|......|...::|.||...||:.:.|
Human    72 QVELLGMILGTETSNKYEIKNSLGQRIYFAVEESICFNRTFCSTLRSCTLRITDNSGREVITVNR 136

  Fly   134 PFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFS 198
            |.:|:...| |..:..:|:.||||.::|.|.|......|||.|:|...:.:|:|.||...|.||.
Human   137 PLRCNSCWC-PCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVGPCVTCGCFG 200

  Fly   199 DTNFKVLSANNE-EIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262
            |.:|:|.:.|.: .||||||.|||...::||:||.|.:..|.:|||.:||.:..|.||..::.:|
Human   201 DVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIHVPADLDVTVKAAMIGACFLFVSMGFE 265

  Fly   263  262
            Human   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 91/227 (40%)
PLSCR5XP_016861862.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm8657
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.