DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and scramb1

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster


Alignment Length:266 Identity:143/266 - (53%)
Similarity:180/266 - (67%) Gaps:14/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PQNAPQDENGAVVLQPQAANVGNNANGP-------------ENWMSIPVGMPNCPQGLEYLTALD 62
            |...|....|....|||...|.....||             .:|||||.|:||||:||||||.:|
  Fly   140 PGGPPNAFGGYPPGQPQQPIVTQPGMGPGMGPGMAPQGGPAGDWMSIPTGIPNCPRGLEYLTTID 204

  Fly    63 QLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNE 127
            ||||.||:|.||..|||||.|:|.:||:|||.||||.|::||||||..|.:|||:|::.||||.|
  Fly   205 QLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQE 269

  Fly   128 VLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVC 192
            |:|::||..|. .|.||.|:.::|||||||.|||::||..:...|.|.|.|..||||::||||.|
  Fly   270 VIHMHRPLACS-SCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFC 333

  Fly   193 PCKCFSDTNFKVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLID 257
            ......|..|.|:|...|:|||||||||||.||:|||||:|.:.|||:|||||||::..|.||||
  Fly   334 TFSLCGDVEFNVVSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLID 398

  Fly   258 AVYYEQ 263
            |:::|:
  Fly   399 AMFFEK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 132/220 (60%)
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 132/220 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460699
Domainoid 1 1.000 58 1.000 Domainoid score I3943
eggNOG 1 0.900 - - E1_KOG0621
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2660
Isobase 1 0.950 - 0 Normalized mean entropy S1940
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm8892
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - P PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
1211.750

Return to query results.
Submit another query.