DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and Plscr4

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_848826.1 Gene:Plscr4 / 235527 MGIID:2143267 Length:326 Species:Mus musculus


Alignment Length:256 Identity:98/256 - (38%)
Similarity:145/256 - (56%) Gaps:4/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPQNAPQDENGAVVLQPQAANVGNNANGPENWMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKLE 74
            :|...|......:..||....| .|...|..||:.|..:||||.|||||..||.:.|.|.:|.||
Mouse    65 IPLYHPTGGTHPIQYQPGKYPV-TNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHVLQHVEPLE 128

  Fly    75 LLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKCDI 139
            |:|.|||.||:.:||::.|.||...|::|..|||.....|||.:::.|....|::.:.|||:|..
Mouse   129 LMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGREIMTMQRPFRCTC 193

  Fly   140 LC-CFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSDTNFK 203
            .| |.|.....:||..|||..||.|.:.....|..::|:|...::::::.||.....|.||:.|:
Mouse   194 CCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFE 258

  Fly   204 VLSANN-EEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYEQ 263
            :.|.:. ..||.|.::|:|. .....:||:|.:.|||.|||:|||:||.:.||||.:|:|:
Mouse   259 INSLDGVSNIGSIIRKWNGF-LSTMVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFER 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 89/222 (40%)
Plscr4NP_848826.1 Proline-rich domain (PRD). /evidence=ECO:0000250 1..94 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
SH3-binding 1. /evidence=ECO:0000255 18..25
DAZAP2 27..>113 CDD:287943 18/48 (38%)
PPxY motif. /evidence=ECO:0000255 30..33
SH3-binding 2. /evidence=ECO:0000255 41..49
SH3-binding 3. /evidence=ECO:0000255 94..102 3/7 (43%)
Scramblase 96..318 CDD:252175 89/222 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.