DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and Plscr1

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_035766.2 Gene:Plscr1 / 22038 MGIID:893575 Length:328 Species:Mus musculus


Alignment Length:234 Identity:123/234 - (52%)
Similarity:159/234 - (67%) Gaps:4/234 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NNANGPEN--WMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNV 95
            |:..||..  ||..|....|||.|||||..:|||||.|:||.||:||||||.|::::||||||.|
Mouse    84 NHPGGPGGTPWMPAPPPPLNCPPGLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRV 148

  Fly    96 YFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVI 160
            |||.|::||||||..|.||||.::||||...||:.|.||.:|. .||||.|:..:|:.||||..:
Mouse   149 YFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCS-SCCFPCCLQEIEIQAPPGVPV 212

  Fly   161 GSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSDTNFKVLSANNEE-IGKISKQWSGLGR 224
            |.|.|......|||.::|.....||::.||...|.|.||.:|::.|.:.|. :|||||||||..|
Mouse   213 GYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVR 277

  Fly   225 ELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYEQ 263
            |.|||||.|.:.|||:|||:|||::..|.||||.:::|:
Mouse   278 EAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFER 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 118/221 (53%)
Plscr1NP_035766.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 4/11 (36%)
Proline-rich domain (PRD). /evidence=ECO:0000250|UniProtKB:O15162 1..93 3/8 (38%)
SH3-binding 1. /evidence=ECO:0000255 18..26
PPxY motif. /evidence=ECO:0000255 22..25
SH3-binding 2. /evidence=ECO:0000255 56..64
SH3-binding 3. /evidence=ECO:0000255 93..101 3/7 (43%)
Scramblase 107..316 CDD:252175 113/209 (54%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O15162 269..275 5/5 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845457
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm8892
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.