DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and scrm-2

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_493321.1 Gene:scrm-2 / 191509 WormBaseID:WBGene00014200 Length:265 Species:Caenorhabditis elegans


Alignment Length:260 Identity:97/260 - (37%)
Similarity:143/260 - (55%) Gaps:14/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NAPQD----ENGAVVLQPQAANVGNNANGPENWMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKL 73
            |.|.|    |:.|:..:|.|:   ..|.....||.....:...|.|||||..||.::|.|..|.|
 Worm     7 NGPPDYVEIEDRAITTEPGAS---IQAAPGAIWMEALPAIEGIPAGLEYLAYLDTVMVHQVKEVL 68

  Fly    74 ELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKC- 137
            |:|||:|:||::.::|..||..|:|:|||:...|...|..|.|.|.|:|||...||.:.|..:| 
 Worm    69 EILTGWESKNKYAIRNKNGQQCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCC 133

  Fly   138 -DILC-CFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVC--PCKCFS 198
             |..| |.....|...:.:....::|:|.|........:||.:..|:.:..::|..|  .| |..
 Worm   134 ADSFCGCLLGLQNICTIESLSTGLLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTSC-CCE 197

  Fly   199 DTNFKVLSANNE-EIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262
            |.:|.:.:.::. .||.|:|:|.||.||.|||||.|:||||::|||::||::..|.||||.|.:|
 Worm   198 DKDFTIKTPDSSVPIGSITKKWGGLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFE 262

  Fly   263  262
             Worm   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 88/227 (39%)
scrm-2NP_493321.1 LOR 40..263 CDD:295149 87/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I1864
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I2390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28609
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm4812
orthoMCL 1 0.900 - - OOG6_100156
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.