DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and scrm-7

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_506646.1 Gene:scrm-7 / 190110 WormBaseID:WBGene00013052 Length:293 Species:Caenorhabditis elegans


Alignment Length:262 Identity:69/262 - (26%)
Similarity:118/262 - (45%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PQDENGAVVLQPQAANVGNNANGPENWMSIPV---GMPNCP--QGLEYLTALDQLLVSQKIEKLE 74
            ||..:..:||..|.|             |:||   |..|.|  ..|:.::..:.::|.|.:|.||
 Worm    28 PQVRSTPIVLPNQVA-------------SMPVRMTGFNNLPAHNVLDMISRTNSMMVVQALEPLE 79

  Fly    75 LLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYR-----P 134
            :.||.||.|::.|.:...:.:....|.|:...|.|.|..|.|.|...|.|...|:..:|     .
 Worm    80 IATGIETPNQYVVHDMYCRPIMNCMERSNGFARQMQGSHRSFAMMCTDLFGAHVMQCHRDQPWGS 144

  Fly   135 FKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSD 199
            |...:...|            .||.||.:.:  |.....|::.....:..|.|..|:     |:.
 Worm   145 FTDHLTTQF------------LGQNIGIMSR--THGDVNFHLLGAGSNQSLLIRSPL-----FAA 190

  Fly   200 T----NFKVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVY 260
            :    :|.|::.|...:|:|.:.:.|..:|:::|||.:.|.||::|...:|.|:.:::||||..:
 Worm   191 SGGTRSFPVMTYNGMRVGEIVRLYPGYMQEMYSDADTYIVHFPMDLPPILKLLLISSVFLIDFTF 255

  Fly   261 YE 262
            :|
 Worm   256 FE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 63/235 (27%)
scrm-7NP_506646.1 Scramblase 48..258 CDD:252175 60/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.