DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and scrm-3

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_503934.2 Gene:scrm-3 / 182212 WormBaseID:WBGene00015437 Length:251 Species:Caenorhabditis elegans


Alignment Length:276 Identity:89/276 - (32%)
Similarity:135/276 - (48%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EYKVLPQNAPQ---DENGAVVLQPQAANVGNNANGPENWMSIPV--------GMP---NCPQGLE 56
            |..::|...|.   .::.|:..||.|              |||:        .:|   ..|.|||
 Worm     2 EQPLMPPAPPSYVASQSQAITTQPGA--------------SIPMPPGTIVIEALPPVEGIPGGLE 52

  Fly    57 YLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKIL 121
            ||..||.::|.|.:|.:|:.||:||||::.:|.       ..|::..||     |..|.|.|.|:
 Worm    53 YLAYLDTIMVHQFLEPIEIRTGWETKNKYAIKK-------ICYQKRQCC-----GAERAFVMHIV 105

  Fly   122 DNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSV--EQVCTFMRPKFNIKNTCGDTV 184
            |||..|||.:.|...|...||:....|...:.:|...::|:|  ...||  ....|:.:...:.:
 Worm   106 DNFNKEVLTVKRERHCCGCCCWLGSTNKSTIESPSMGLLGTVLLGHGCT--NSHCNVLDKDEELL 168

  Fly   185 LQIEGPVCPCK--CFSDTNFKVLSANN-EEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMK 246
            ..::|..| |.  |..|..|.:.:.:. :.||.|:|:|.|:.||.:||||.|:||||.:|||:.|
 Worm   169 FLVDGQGC-CTYCCCDDKAFTIKTPDTYKRIGAITKKWGGIIREAYTDADTFAVTFPADLDVKAK 232

  Fly   247 ALIFAALFLIDAVYYE 262
            ||:.|..|:||...:|
 Worm   233 ALLLATTFVIDFAEFE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 82/237 (35%)
scrm-3NP_503934.2 LOR 41..249 CDD:295149 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 193 1.000 Domainoid score I1864
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I2390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28609
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm4812
orthoMCL 1 0.900 - - OOG6_100156
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.