DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and Plscr1

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006243598.1 Gene:Plscr1 / 117540 RGDID:620521 Length:352 Species:Rattus norvegicus


Alignment Length:260 Identity:128/260 - (49%)
Similarity:169/260 - (65%) Gaps:6/260 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YKVLPQNAPQDENGAVVLQPQAANVGNNANGPEN--WMSIPVGMPNCPQGLEYLTALDQLLVSQK 69
            |.|.|.:....:.....:|.|.|.  |:..||..  ||..|....:||.||||||.:||:||.|:
  Rat    85 YPVPPGSYAGGDPSGFPVQHQPAY--NHPGGPGGTPWMQAPPPPLDCPPGLEYLTQIDQILVHQQ 147

  Fly    70 IEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRP 134
            ||.||:||||||.|::::||||||.||||.|::||||||..|.||||.::||||...||:.|.||
  Rat   148 IELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERP 212

  Fly   135 FKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSD 199
            .:|. .||||.|:..:|:.||||..:|.|.|......|||.::|.....||::.||...|.|.||
  Rat   213 LRCS-SCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSD 276

  Fly   200 TNFKVLSANNEE-IGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYEQ 263
            .:|::.|.:.|. :|||||||||..||.|||||.|.:.|||:|||:|||::..|.||||.:::|:
  Rat   277 IDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFER 341

  Fly   264  263
              Rat   342  341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 117/221 (53%)
Plscr1XP_006243598.1 Scramblase 132..341 CDD:252175 113/209 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm9137
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.