DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and LOC102551265

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006243606.1 Gene:LOC102551265 / 102551265 RGDID:7575278 Length:233 Species:Rattus norvegicus


Alignment Length:212 Identity:95/212 - (44%)
Similarity:139/212 - (65%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPF 116
            |.|||||..:|.:|:.|:.|.:|.:.||||.|::|:|:.|||.||:|.|:|:..|||..|.:|||
  Rat    11 PPGLEYLLQIDHILIHQQFEFVEAILGFETANQYKIKDKLGQKVYYAIEDSNFLTRNCCGDNRPF 75

  Fly   117 EMKILDNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCG 181
            .|:|:||..:||:.|.||.:||...| |.|:..:||.||||..||.:.|.....||||.::|...
  Rat    76 SMRIIDNSGHEVITLQRPLRCDSCFC-PCCLQKMEVQAPPGVPIGYIIQTWHPCRPKFTVQNEEK 139

  Fly   182 DTVLQIEGPVCPCKCFSDTNFKVLSANNE-EIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRM 245
            ..||:|.||:..|....:.:|::.|.:.. .:|:|||.|||..:|:.||.|.|.:.|||:|||::
  Rat   140 QDVLKIIGPIITCSFGGNVDFEIKSLDEAFVVGRISKHWSGFLKEILTDVDSFGIQFPLDLDVKI 204

  Fly   246 KALIFAALFLIDAVYYE 262
            ||::..|.||||.:::|
  Rat   205 KAVMLGACFLIDFMFFE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 95/212 (45%)
LOC102551265XP_006243606.1 Scramblase 10..222 CDD:252175 95/212 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm9137
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.