DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and LOC101731311

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031755435.1 Gene:LOC101731311 / 101731311 -ID:- Length:219 Species:Xenopus tropicalis


Alignment Length:244 Identity:59/244 - (24%)
Similarity:98/244 - (40%) Gaps:62/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QDENGAVVLQPQAANVGNNANGPENWMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFE 80
            ||....:..|||..:....::..:.....||    .|.|:|.|..:|::...:|:        ||
 Frog     6 QDPAKPIQTQPQWQSASGTSHPGQYSRPYPV----VPPGIESLVEVDEVTFRKKV--------FE 58

  Fly    81 TKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKCDILCCFPS 145
            |.:        ||.:|...::.:||       ..|..:|:.|.::.||||.:       |.....
 Frog    59 TPD--------GQILYSVKQDWECC-------GNPLILKLKDPYEREVLHAH-------LLAESG 101

  Fly   146 CMNA---VEVSAPPGQVIGSVEQVCTFMRPK----FNIKNTCGDTVL--QIEGPVCPCKCFSDTN 201
            |.|:   ::|.||||..||.|.     .|.|    |:|.:...:.:.  ||:....|.|     .
 Frog   102 CCNSYRELQVEAPPGYPIGFVS-----YRSKRGLQFSISDEQREPIFTSQIKSHSFPKK-----P 156

  Fly   202 FKVLSA-NNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALI 249
            .::.|. .:..||:|.|        :........:.||.:|:.:|||:|
 Frog   157 TEICSVQGSHPIGRILK--------IKGKPSKIVIQFPRDLEAKMKAVI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 54/218 (25%)
LOC101731311XP_031755435.1 LOR 33..198 CDD:413170 54/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.