DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and si:ch73-170d6.4

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017211321.1 Gene:si:ch73-170d6.4 / 100537119 ZFINID:ZDB-GENE-161017-92 Length:200 Species:Danio rerio


Alignment Length:191 Identity:68/191 - (35%)
Similarity:101/191 - (52%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNM-LGRSRPFEMKILDNFQNEVLHLYRPFKC 137
            |:..|.....|:.||:.:|.:|:...|:||.|:||: .|||  |.|.|:::...||:.|..||.|
Zfish     7 EVCCGKNLDIRYTVKDDIGNHVFSILEDSDYCSRNIHTGRS--FTMNIVNDSNKEVIRLEHPFIC 69

  Fly   138 DILCCFPSCM-NAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFSDTN 201
                  .||. :.|||.:|||..:|.|.|.....:|||.::|...:...:|.||..|.....|..
Zfish    70 ------WSCSGHEVEVQSPPGVPVGHVRQNWHVCQPKFTVENNQREPEFKIVGPCVPLSFCVDQE 128

  Fly   202 FKVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262
            |:::|.:....|||.|.:|.....:..|   |.:.||:||:.:|||.:..|..|||.|||:
Zfish   129 FELVSLSGSAFGKIVKPFSCSCVNVNAD---FVLQFPVNLEDKMKATLLGACVLIDFVYYD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 68/191 (36%)
si:ch73-170d6.4XP_017211321.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.