DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and Plscr5

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001182622.1 Gene:Plscr5 / 100504689 MGIID:3779462 Length:274 Species:Mus musculus


Alignment Length:260 Identity:98/260 - (37%)
Similarity:151/260 - (58%) Gaps:16/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPQNAPQDENGAVVLQPQAANVGNNA------NGPENWMSIPVGMPNCPQGLEYLTALDQLLVSQ 68
            ||:....|:|.    |..::|....|      :.|.::  :|..  ..|.|||||:.||.:::.|
Mouse    18 LPRATNPDQNS----QEASSNPRKQARQQPGVSQPSSF--LPTA--TLPPGLEYLSQLDLIIIHQ 74

  Fly    69 KIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYR 133
            ::|.|.::.|.||.|::::||||||.:|||.|||.|..||:....|...::|.||...||:.:.|
Mouse    75 QVELLGMILGTETSNKYEIKNSLGQRIYFAVEESICFNRNVCSTLRACTLRITDNSGREVITVNR 139

  Fly   134 PFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCFS 198
            |.:|:...| |..:..:|:.||||.::|.|.|.....:|||.|:|...:.:|:|.||...|.||.
Mouse   140 PLRCNSCWC-PCYLQELEIQAPPGTIVGYVAQKWGPFQPKFTIQNANKEDILKIIGPCTTCGCFG 203

  Fly   199 DTNFKVLSANNE-EIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262
            |.:|:|.:.:.: .||||||.|||...::||:||.|.:..|.:|||.:||.:..|.||.|.:::|
Mouse   204 DVDFEVKTVDEKVTIGKISKYWSGFVNDVFTNADNFGIHVPADLDVTLKAAMIGACFLFDFMFFE 268

  Fly   263  262
            Mouse   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 90/222 (41%)
Plscr5NP_001182622.1 Scramblase 48..268 CDD:252175 90/224 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.