DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and LOC100497953

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002937394.3 Gene:LOC100497953 / 100497953 -ID:- Length:413 Species:Xenopus tropicalis


Alignment Length:208 Identity:53/208 - (25%)
Similarity:102/208 - (49%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMK 119
            |:.|:...|..::.|.:...|  ....:..:.:.....:.:..|.|:|.|...::.|.:|...::
 Frog   207 LQILSGAQQFCITSKSKPQGL--SCHPERSYVISTRSSKQLLVAIEDSSCLCLHLCGPARSCSLR 269

  Fly   120 ILDNFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTV 184
            :.|..:.|||...||::.| :||...|:..:.|.:..|.:||||:|..:...|...:.:..|..:
 Frog   270 LCDYSKEEVLRFCRPYRVD-MCCLFCCLMVISVFSSSGNLIGSVQQRWSLFSPSLAVYDAYGRKI 333

  Fly   185 LQIEGPVCPCKCFSDTNFKVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALI 249
            ::|:|.....:|.:|..|:|.|.:.:.:..|.|:|.|...:...|.|:|.:....:|.....||:
 Frog   334 MEIKGSWSATRCHTDQEFQVTSLDGQLLAVIWKRWPGFNMDYNMDHDFFGINISASLSPAEIALL 398

  Fly   250 FAALFLIDAVYYE 262
            .||.||::.:|:|
 Frog   399 LAAAFLLNYMYFE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 53/208 (25%)
LOC100497953XP_002937394.3 LOR 235..411 CDD:382820 47/176 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.