DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and plscr2

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_012818771.1 Gene:plscr2 / 100489273 XenbaseID:XB-GENE-5819744 Length:283 Species:Xenopus tropicalis


Alignment Length:262 Identity:126/262 - (48%)
Similarity:170/262 - (64%) Gaps:11/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QMSEYKVLPQNAPQDENG-AVVLQPQAANVGNNANGPENWMSIPVGMPNCPQGLEYLTALDQLLV 66
            |.:.|...|....|.:.| |:..||......        ||.||...||||.|||||:.:||:||
 Frog    28 QQNPYGYPPPGPYQFQPGQAMPTQPGVPGAA--------WMPIPAANPNCPPGLEYLSQIDQILV 84

  Fly    67 SQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHL 131
            .|::|.||:||||||.|::::||||||.||||.||:||||||..|.||||.|.|:||...||:.|
 Frog    85 HQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKL 149

  Fly   132 YRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKC 196
            :||.:|. .||||.|:..:||.||||.|:|.|.|......|||.|::.....||:|.||..||:|
 Frog   150 HRPLRCS-ACCFPCCLQKLEVQAPPGTVVGYVVQNWHPCLPKFTIQDEREQGVLKISGPCIPCRC 213

  Fly   197 FSDTNFKVLSANNEE-IGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVY 260
            .:|.||:|:|.:... :|:|||||:|..:|:|||.|.|.:.||::||::.||::..|.||||.::
 Frog   214 CTDVNFEVMSVDESSVVGRISKQWAGSVKEIFTDTDNFGIQFPMDLDIKTKAVLLGACFLIDFMF 278

  Fly   261 YE 262
            :|
 Frog   279 FE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 117/222 (53%)
plscr2XP_012818771.1 Scramblase 60..280 CDD:252175 116/220 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm9553
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.