DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and LOC100489081

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031755478.1 Gene:LOC100489081 / 100489081 -ID:- Length:237 Species:Xenopus tropicalis


Alignment Length:261 Identity:70/261 - (26%)
Similarity:111/261 - (42%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YKVLPQNAPQDENGAVVLQPQAANVGNNANGPENWMSIPVGMPNCPQGLEYLTALDQLLVSQKIE 71
            |..:...||.|:     ..|.|.::......|               |.|.|..::||.:.   |
 Frog    16 YNTIAPYAPPDQ-----YPPVAQHLATTGASP---------------GSELLAQINQLSIR---E 57

  Fly    72 KLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFK 136
            |.::..|:  ...|.|.||.||.::.|.:.:..|       ....::.|.||..|||:......|
 Frog    58 KFKVSQGW--GRSFDVLNSDGQRIFQAEQSAHFC-------GPVLDVNIRDNSGNEVMEFIDTCK 113

  Fly   137 CDILCCFPSCMNAVEVSAPPGQVIGSV----EQVCTFMRPKFNIKNTCGDTVLQIEGPVCPCKCF 197
            |       ||...:||..|.|..:|.|    .|:.|.|    :|.|:...|||.|.||......|
 Frog   114 C-------SCSREMEVYWPRGFPVGYVTLHWNQMVTHM----SIMNSAKQTVLLIIGPSFRSGIF 167

  Fly   198 SDTNFKVLSANNEEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262
            .::.|:|.|.:.:.:..:.:.          :.:.|||:|||:|:|.:||::..|.|.:||:.|:
 Frog   168 GNSCFEVKSTDEQHVVGVIRH----------ENESFSVSFPLDLEVAIKAVLLGASFYLDAIIYQ 222

  Fly   263 Q 263
            |
 Frog   223 Q 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 62/224 (28%)
LOC100489081XP_031755478.1 LOR 38..217 CDD:413170 60/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.