DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb2 and plscr1

DIOPT Version :9

Sequence 1:NP_647761.1 Gene:scramb2 / 38362 FlyBaseID:FBgn0035390 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031757431.1 Gene:plscr1 / 100216165 XenbaseID:XB-GENE-967763 Length:341 Species:Xenopus tropicalis


Alignment Length:272 Identity:128/272 - (47%)
Similarity:173/272 - (63%) Gaps:16/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QMSEYKVLPQNAPQDENGAVVLQPQAANVG---------NNANGP-ENWMSIPVGMPNCPQGLEY 57
            |.:..:|.|...|....|    ||..||.|         |....| ..||..|..:||||.||||
 Frog    70 QTAGAQVPPGYPPGPYQG----QPGQANFGAYGGPHAVPNQPGAPAAAWMPAPAPIPNCPPGLEY 130

  Fly    58 LTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILD 122
            ||.:||:||.|::|.||:||||||.|::::||||||.||||.||:||||||..|.||||.|.|:|
 Frog   131 LTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVD 195

  Fly   123 NFQNEVLHLYRPFKCDILCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQI 187
            |...||:.|:||.:|. .||||.|:..:||.||||..:|.|.|......|||.|::.....:|:|
 Frog   196 NAGQEVMKLHRPCRCS-ACCFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKI 259

  Fly   188 EGPVCPCKCFSDTNFKVLSANNEE-IGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFA 251
            :||..||:|.:|..|::.|.:... :|:|:|||:|..:|.|||||.|.:.||::|||::||::..
 Frog   260 KGPCIPCRCCADVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLG 324

  Fly   252 ALFLIDAVYYEQ 263
            |.||||.:::||
 Frog   325 ACFLIDFMFFEQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb2NP_647761.1 Scramblase 42..263 CDD:252175 113/221 (51%)
plscr1XP_031757431.1 Scramblase 123..336 CDD:252175 110/213 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm9553
Panther 1 1.100 - - O PTHR23248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.