DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2162 and r3hcc1

DIOPT Version :9

Sequence 1:NP_001163332.2 Gene:CG2162 / 38360 FlyBaseID:FBgn0035388 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_012814891.1 Gene:r3hcc1 / 100488291 XenbaseID:XB-GENE-22069043 Length:469 Species:Xenopus tropicalis


Alignment Length:509 Identity:109/509 - (21%)
Similarity:193/509 - (37%) Gaps:124/509 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RRERRPDRAVYVPRAR---RSQTTPPTTTTTTTAAAATAVATTSPPAAAAVVAATITTAPDSPPV 273
            ::.|:||:|:||||.|   |........:..:.........|..|                    
 Frog    11 KKNRKPDQALYVPRGRFGGRGNNMAGDMSRKSQKEEEKREETEKP-------------------- 55

  Fly   274 ADTQPSKADDV-NGQPPSKSKKSK-----SHRERRERAKKTTTATTADNAT------VLVISASE 326
            .|......:.| .|:...|.::::     :.|||:...:.....|:|...|      |..:.|.|
 Frog    56 GDVHLQVVESVGEGENLEKGEENELGEGCAERERKISIEDEVEITSAVQTTEESEKRVKCLKAEE 120

  Fly   327 NDTQSNEEHRPAKPADCDKEIMSGAQRTKPGNGNKSASNGKSQ------------ASP------- 372
            ...:.|||       |...|.....:..:|.:|:.:|:...|:            .||       
 Frog   121 EKQKENEE-------DMQTERTDHGEENQPRSGDINATKQNSELCESRRAELHIIISPSGETQKL 178

  Fly   373 -----PLRIEDVVAARSTNGEEP-----------------AKC----------DNDVRELQRASK 405
                 |..:....:....|..||                 |:|          |::.:..:|...
 Frog   179 GAVMQPSELGSPESISEENRREPGDILLPERPAETTEGSLAECTDLPGPSEAKDSENKGTERNQG 243

  Fly   406 EINRSNRRIMKQTFNSDVLEIPEKIETSATKAIPTSPQASATAKPPVDSTTEDDDEEDEDDWEKM 470
            | |:...:...|....|...|....|.:.         ||..||..:..:....|.::|...|..
 Frog   244 E-NKGENKQCAQNNKGDTCTIIGGHEAAV---------ASEEAKSLLCDSYRQGDAQEEGISEPA 298

  Fly   471 FD-----ESGDCLDPKLLQELTESVGKCKIELPKM--DYTVFHIKQQLLNEEEFPHVLEVSNFPV 528
            .|     |||  :..::::|:..:|.:..:::..:  |:..:  .:...:...|.||:|:..|..
 Frog   299 LDAASPAESG--ILQQIIKEIIANVSEKDVQIQPLLNDFAAY--AEDQTDHGRFGHVIEIYGFSR 359

  Fly   529 EFKTPDLLMLFAQYR-GSGFDIKWVDDTHALAVFSSSRIAAEVLTMGHPFVKLKPLAEATLESRL 592
            |.:|.||...|.:|| ..||.::|||.:|||.:|||...|.......:|.:|.:||::...:|::
 Frog   360 ELRTEDLTKPFIEYREQGGFQLQWVDQSHALGIFSSPEDAYSASCKSYPGMKFRPLSQGCHQSKM 424

  Fly   593 KAKKAGAVSMQPYRQRPETCTALARRLVSGALGVKLPTAPQERENERRVLREAK 646
            ||.:  .......::||:|...:|:|::|.|||     .||  ::....||::|
 Frog   425 KAHE--CAEFHSSKERPQTDFTVAKRMLSRALG-----HPQ--QDGDHTLRDSK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2162NP_001163332.2 R3H 6..70 CDD:294210
RRM_SF 519..583 CDD:302621 25/64 (39%)
r3hcc1XP_012814891.1 RRM_SF 349..415 CDD:388407 25/65 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D363445at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.