DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and PGLP2

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_199587.1 Gene:PGLP2 / 834827 AraportID:AT5G47760 Length:301 Species:Arabidopsis thaliana


Alignment Length:316 Identity:104/316 - (32%)
Similarity:168/316 - (53%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNKYGIQQWLKTIDTIIFDGNGVLWSHGKVLENAAETFNALRAMGKKAFICTNNSVTSVEGICKY 83
            |:....:....::||.:||.:||:|....:::..::|.:.:|:.||.....|||||.|..   :|
plant     6 LSSSNFKSLFDSVDTFLFDCDGVIWKGETLIDGVSQTLDLIRSKGKNVVFVTNNSVKSRR---QY 67

  Fly    84 AQEMGFL----VAKNEILSSVQTLAKFMKEKKF--KKKCYVVGGQGIVDELKLVGIESL--PLD- 139
            |::...|    :.::||.||....|.::|...|  .||.||:||:|:::||::.|...|  |.| 
plant    68 AEKFRSLGVTSITQDEIFSSSFAAAMYLKVNNFPKDKKVYVIGGEGVLEELQIAGFTGLGGPEDG 132

  Fly   140 --HSSLQGFSMPDHIHSIYLDPNVGAVVVGSDKDFNTIKLTKACCYLRDSE-VMFVATSRDAALP 201
              .:..:..|:.:|      |.:|||||||.|.:.|..||......:|::. .:|:||:|||.  
plant   133 EKKAQWKSNSLFEH------DKSVGAVVVGLDPNINYYKLQYGTLCVRENPGCLFIATNRDAV-- 189

  Fly   202 AAPGRMV-----PSAGVMVAAIQAASQRMPFTCGKPNPYMCIDLMQKGVIQPDRTLIIGDTMCTD 261
               |.|.     |.||.||||:..:::|.|...|||:.:|...|:||...:..|..::||.:.||
plant   190 ---GHMTDLQEWPGAGCMVAAMCGSTEREPIVVGKPSTFMMDFLLQKFGTETSRMCMVGDRLDTD 251

  Fly   262 ILLGYKCGFQTLLVGTGVNSYQDAIEAQGSKAPLLYQQVPDLYMPKLSNLLPFLSS 317
            ||.|...|.:||||.|||.|..:.:: :|:|..      ||.|...:|:::..:.|
plant   252 ILFGQNAGCKTLLVLTGVTSESNLLD-KGNKIE------PDYYTSTVSDIIKLMES 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 102/297 (34%)
Hydrolase_6 34..134 CDD:290083 35/105 (33%)
Hydrolase_like 229..>281 CDD:289983 23/51 (45%)
PGLP2NP_199587.1 PLN02645 1..301 CDD:178251 104/316 (33%)
Hydrolase_6 21..124 CDD:290083 35/105 (33%)
Hydrolase_like 218..293 CDD:289983 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I1438
OMA 1 1.010 - - QHG60740
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 1 1.000 - - FOG0000783
OrthoInspector 1 1.000 - - mtm1035
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X675
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.