DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and LHPP

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_016871998.1 Gene:LHPP / 64077 HGNCID:30042 Length:381 Species:Homo sapiens


Alignment Length:256 Identity:49/256 - (19%)
Similarity:97/256 - (37%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIFDGNGVLWSH----GKVLENAAETFNALRAMGKKAFICTNNSVTSVEGICKYAQEMGFLVAKN 94
            ::.|.:|||:..    |..:..:.|....|:....|...|||.|..|...:....|.:||.:::.
Human    14 VLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQ 78

  Fly    95 EILSSVQTLAKFMKEKKFKKKCYVVGGQGIVDELKLVGIESLPLDHSSLQGFSMPDHIHSIYLDP 159
            |:.:......:.:||:..:.  |::...|:..|.                     |.|.:  .:|
Human    79 EVTAPAPAACQILKEQGLRP--YLLIHDGVRSEF---------------------DQIDT--SNP 118

  Fly   160 NVGAVVVGSDKDFNTIKLTKACCYLRDSEVMFVATSRDAALPAAPGRMVPSAGVMVAAIQAASQR 224
            |. .|:..:.:.|:...:..|...|.:.|       :...:....||.......::..:....:.
Human   119 NC-VVIADAGESFSYQNMNNAFQVLMELE-------KPVLISLGKGRYYKETSGLMLDVGPYMKA 175

  Fly   225 MPFTC-------GKPNPYMCIDLMQKGVIQPDRTLIIGDTMCTDILLGYKCGFQTLLVGTG 278
            :.:.|       |||:|......:|...::..:.::|||.:..|:....:||.:.|.|.||
Human   176 LEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 49/256 (19%)
Hydrolase_6 34..134 CDD:290083 22/103 (21%)
Hydrolase_like 229..>281 CDD:289983 16/57 (28%)
LHPPXP_016871998.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.