DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and Hdhd2

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001014173.2 Gene:Hdhd2 / 361351 RGDID:1308579 Length:384 Species:Rattus norvegicus


Alignment Length:244 Identity:55/244 - (22%)
Similarity:96/244 - (39%) Gaps:42/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LRAMGKKAFICTNNSVTSVEGICKYAQEMGFLVAKNEILSSVQTLAKFMKEKKFKKKCYVVGGQG 123
            |||........||.:..|...:.:..:::.|.:::.||.:|:......:::::            
  Rat   160 LRAASVMVRFVTNTTKESKRDLLERLRKLEFDISEEEIFTSLTAARNLIEQRQ------------ 212

  Fly   124 IVDELKLVGIESLPLDHSSLQGFSMPDHIHSIYLDPNVGAVVVG-SDKDFNTIKLTKACCYLRDS 187
             |..:.||...:|| |.:.:|       .|    |||  |||:| :.:.|:...|.:|...|.|.
  Rat   213 -VRPMLLVDDRALP-DFTGVQ-------TH----DPN--AVVIGLAPEHFHYQLLNEAFRLLLDG 262

  Fly   188 EVMFVA-----TSRDAALPAAPGRMVPSAGVMVAAIQAASQRMPFTCGKPNPYMCIDLMQKGVIQ 247
            ..:...     ..|...|...|       |..|.|::.|:.......|||.....::.::.....
  Rat   263 APLIAIHKARYYKRKDGLALGP-------GPFVTALEYATDTKAVVVGKPEKTFFLEALRDTDCA 320

  Fly   248 PDRTLIIGDTMCTDILLGYKCGFQTLLVGTGVNSYQDAIEAQGSKAPLL 296
            |:..::|||....|:......|...:||.||  .|:.|.|.:.:..|.|
  Rat   321 PEEAVMIGDDCRDDVDGAQNIGMLGILVKTG--KYKAADEEKINPPPYL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 55/244 (23%)
Hydrolase_6 34..134 CDD:290083 13/74 (18%)
Hydrolase_like 229..>281 CDD:289983 13/51 (25%)
Hdhd2NP_001014173.2 Yos1 5..>64 CDD:285740
HAD-SF-IIA-hyp3 122..382 CDD:162372 55/244 (23%)
HAD_like <159..>211 CDD:304363 10/50 (20%)
Hydrolase_like 301..375 CDD:289983 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.