DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and CG17294

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster


Alignment Length:258 Identity:63/258 - (24%)
Similarity:99/258 - (38%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TIDTIIFDGNGVLWSHGKVLENAAETFNALRAMGKKAFICTN----NSVTSVEGICKYAQEMGFL 90
            :|...:.|.:|.|....:...||.|....||..|......||    :..|..|.:|:    :||.
  Fly     2 SIKGALIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCR----IGFQ 62

  Fly    91 VAKNEILSSVQTLAKFMKEKKFKKKCYVVGGQGIVDELKLVGIESLPLDHSSLQGFSMPDHIHSI 155
            :..:||.||:.....:::.::...  |.:                  |...:.|.|  |......
  Fly    63 LDASEIYSSLSAAVSYVENERLNP--YYI------------------LSEDARQDF--PPEDTRR 105

  Fly   156 YLDPNVGAVVVG-SDKDFNTIKLTKAC-CYLRDSEVMFVATSRDAALPAAPGRMVPSAGVMVAAI 218
            |.|    :||:| :.|.||..:|.:|. ..|.:.....:|..:......|.| :....|..|..:
  Fly   106 YKD----SVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEG-LALGPGCFVKGL 165

  Fly   219 QAASQRMPFTCGKPNPYMCIDLMQKGVI---QPDRTLIIGDTMCTDILLGYKCGFQTLLVGTG 278
            :.|:.|.....||||||..     :|.:   .|...::|||....||:.....|.|.:||.||
  Fly   166 EFATGRTAKVIGKPNPYFF-----EGALAGRDPASCVMIGDDANDDIVGAMSMGMQGILVKTG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 63/258 (24%)
Hydrolase_6 34..134 CDD:290083 21/103 (20%)
Hydrolase_like 229..>281 CDD:289983 19/53 (36%)
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 63/257 (25%)
Hydrolase_6 7..98 CDD:290083 23/114 (20%)
DUF843 <84..136 CDD:114536 16/77 (21%)
Hydrolase_like 175..245 CDD:289983 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.