DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and CG10352

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster


Alignment Length:299 Identity:76/299 - (25%)
Similarity:135/299 - (45%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QWLKTIDTIIFDGNGVLWSHGK-VLENAAETFNALRAMGKKAFICTNNSVTSV-EGICKYAQEMG 88
            ::..:.|.:..|.:||:|...: .:..:||....|..:||.....||||::|| |.|.|:.::..
  Fly    17 EFFDSFDLVFCDCDGVVWYPLRDFIPGSAEALAHLAHLGKDVTFVTNNSISSVKEHIEKFEKQGH 81

  Fly    89 FLVAKNEILSSVQTLAKFMKEKKFKKKCYVV-------------------GGQGIVDELKLVGIE 134
            ..:.:::|:...||:...::..||:...|.:                   .|.||:..||     
  Fly    82 LKIDEHQIVHPAQTICDHLRSIKFEGLIYCLATSPFKEILVNAGFRLAQENGSGIITRLK----- 141

  Fly   135 SLPLDHSSLQGFSMPDHIHSIYLDPNVGAVVVGSDKDFNTIKLTKACCYLRDSEVMFVATSRDAA 199
                           |...:|:...:|.||::..|.:.:..||.:|...|::.:.:|:|.:.||.
  Fly   142 ---------------DLHEAIFSGESVDAVIIDVDFNLSAAKLMRAHFQLQNPKCLFLAGAADAL 191

  Fly   200 LPAAPGRMVPSAGVMVAAIQAASQRMPFTCGKPNPYMCIDLMQK-GVIQPDRTLIIGDTMCTDIL 263
            :|...|.:: ..|..:..:..|..|.|.|.|||...:...|::: ..|.|.|.|.:||::.:||.
  Fly   192 IPFGKGEII-GPGAFIDVVTQAVGRQPITLGKPGEDLRKLLLERHREIPPSRVLFVGDSLASDIG 255

  Fly   264 LGYKCGFQTLLVGTGVNSYQDAIEAQGSKAPLLYQQVPD 302
            .....|:|||||.||....:|.     .:.|:.:.|:||
  Fly   256 FARASGYQTLLVLTGGTKLEDV-----QRLPIDHSQMPD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 76/295 (26%)
Hydrolase_6 34..134 CDD:290083 29/120 (24%)
Hydrolase_like 229..>281 CDD:289983 20/52 (38%)
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 76/293 (26%)
Hydrolase_6 25..127 CDD:290083 24/101 (24%)
Hydrolase_like 220..293 CDD:289983 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1709
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.