DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and CG15739

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster


Alignment Length:304 Identity:88/304 - (28%)
Similarity:150/304 - (49%) Gaps:14/304 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILGLNKYGIQQWLKTIDTIIFDGNGVLWSHGKVLENAAETFNALRAMGKKAFICTNNSVTSVEGI 80
            ||.|::......:.:.|.::.|.:||||:..:.:..||:.:.||..|||.....|||||.:.|..
  Fly     7 ILQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQC 71

  Fly    81 CKYAQEMGFLVAKNEILSSVQTLAKFMKEKKFKKKCYVVGGQGIVDELKLVGIESL--PLDHSSL 143
            .|...::|..|...:|....:::..:::..||:...|::..|.....|:..|.:.|  |.:....
  Fly    72 VKLFAKIGMQVHPEQIWHPAKSIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEE 136

  Fly   144 QGFSMPDHIHSIYLDPNVGAVVVGSDKDFNTIKLTKACCYLRDSEVMFVATSRDAALPAAPGRMV 208
            ...|:.:||..  .:| |.||::..|.:..:.|:.:|..|||..|.|.:..:.|..||.|....:
  Fly   137 SYASLAEHIFG--KEP-VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAKEVNI 198

  Fly   209 PSAGVMVAAIQAASQRMPFTCGKPNPYMCIDLMQK--GVIQPDRTLIIGDTMCTDILLGYKCGFQ 271
            ...|...:.:..||.:.|.|.|||...:. ||:.:  .::||.|.|:|||.:..|:..|.:||||
  Fly   199 VGPGAFASILVEASGKQPITLGKPGRELG-DLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQ 262

  Fly   272 TLLVGTGVNSYQDAIEAQGSKAPLLYQQVPDLYMPKLSNLLPFL 315
            ||||.:|..|.::.:      |....|::||.|...::::...|
  Fly   263 TLLVLSGGCSKEELL------AETDPQRIPDYYADSVADVAQML 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 84/284 (30%)
Hydrolase_6 34..134 CDD:290083 28/99 (28%)
Hydrolase_like 229..>281 CDD:289983 23/53 (43%)
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 84/282 (30%)
Hydrolase_6 25..125 CDD:290083 28/99 (28%)
Hydrolase_like 219..295 CDD:289983 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I299
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.