DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and Hdhd5

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006237308.2 Gene:Hdhd5 / 312680 RGDID:1306557 Length:423 Species:Rattus norvegicus


Alignment Length:354 Identity:71/354 - (20%)
Similarity:124/354 - (35%) Gaps:117/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIFDGNGVLWSHGKVLENAAETFNAL-RAMGK----KAFICTNNSVTSVEGICKYAQEMGFL--- 90
            ::||.:|||....:|:..|.|.|:.| .:.|:    ..|:....::...:    .|||:..|   
  Rat    49 LLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLQVPVVFVTNAGNILQRD----KAQELSALLEC 109

  Fly    91 -VAKNEILSSVQTLAKFMKEKKFKKKCYVVGGQG-IVDELKLVGIESL-----------PLDHSS 142
             |..::::.|...:..|:   ::..|..:|.||| :|:..:.:|.:::           .||...
  Rat   110 KVDPDQVILSHSPMKLFL---QYHNKRMLVSGQGPLVENARALGFQNVVTVDDLRIAFPELDMVD 171

  Fly   143 LQGFSMPDHIHSIYLDPN------VGAVVVGSDKDFNT-IKLTKACCYLRDSEVMFVATSRDAAL 200
            ||  ..|..: .|...|.      .|.:::|....:.| ::|.        ::|:.......|.|
  Rat   172 LQ--RRPKTM-VIRTRPRSDFPAIEGVLLLGEPVRWETNLQLI--------TDVLLSNGHPGAGL 225

  Fly   201 PAAPGRMVPSAGVMVAAIQAASQRMP-------FTC-------------------GKPN--PYMC 237
            ..||...:|.....:..:..|...||       ..|                   |||:  .|..
  Rat   226 ATAPYPHLPVLASNMDLLWMAEASMPRFGHGTFLLCLETIYRKITGHELKYEGLMGKPSILTYRY 290

  Fly   238 IDLM------QKGVIQPDRTL-IIGDTMCTDIL------------------------------LG 265
            .:.:      ::|...|.|.| .|||...:|:.                              ..
  Rat   291 AEEVIRQQAERRGWAAPIRKLYAIGDNPMSDVYGANLFHQYLQMANGGEKEQRADGQEKQRPSAA 355

  Fly   266 YKCGFQTLLVGTGVNSYQDAIEAQGSKAP 294
            ..|.  ::||.||:.|.||    .||:||
  Rat   356 RSCA--SVLVCTGIYSSQD----PGSQAP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 71/354 (20%)
Hydrolase_6 34..134 CDD:290083 26/109 (24%)
Hydrolase_like 229..>281 CDD:289983 18/109 (17%)
Hdhd5XP_006237308.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.