DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32487 and CG2680

DIOPT Version :9

Sequence 1:NP_728791.1 Gene:CG32487 / 38358 FlyBaseID:FBgn0052487 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_570021.2 Gene:CG2680 / 31257 FlyBaseID:FBgn0024995 Length:305 Species:Drosophila melanogaster


Alignment Length:313 Identity:86/313 - (27%)
Similarity:153/313 - (48%) Gaps:28/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILGLNKYGIQQWLKTIDTIIFDGNGVLWSHGKVLENAAETFNALRAMGKKAFICTNNSVTSVEGI 80
            ||.|:....:|::.:.|.:|.|.:||:|.....:.|.....|||:|.||:....:|||..|.|  
  Fly     7 ILKLSLEEQRQFIDSFDLVISDCDGVVWLLVGWIPNTGAAVNALKAAGKQIKFVSNNSFRSEE-- 69

  Fly    81 CKYAQEMGFLVAKN----EILSSVQTLAKFMKEKKFKKKCYVVGGQGIVDELKL--VGIESLPL- 138
             .|.::...:.|||    :|:..|:|:.:::|:.|..::.|.:......:.|:.  :..|||.: 
  Fly    70 -DYMEKFRHIGAKNVQEDDIVHPVKTIVRYLKKHKPGERVYSLMSLEANETLRKHNIEFESLQVK 133

  Fly   139 DHSSLQGFSMPDHIHSIYLDPNVGAVVVGSDKDFNTIKLTKACCYLRDS-EVMFVATSRDAALPA 202
            :|  |...|:.||   :.::..||||:.....|.:.::|.||..:|::: :...:|...|..:|.
  Fly   134 EH--LTAASLVDH---LAIEKPVGAVLFDIHLDLSYVELAKAIRHLQENDDCQLIAGGSDVIMPL 193

  Fly   203 APGRMVPSAGVMVAAIQAASQRMPFTCGKPNPY---MCIDLMQKGVIQPDRTLIIGDTMCTDILL 264
            |....|......:..::..:||.....|||:|.   |..::.:  :....|.:.||||:..|:..
  Fly   194 AENLNVAGFFDFLEHVKRYTQREATFLGKPSPILGEMFGEMFE--IRDCKRCIFIGDTLVQDVQF 256

  Fly   265 GYKCGFQTLLVGTGVNSYQDAIEAQGSKAPLLYQQVPDLYMPKLSNLLPFLSS 317
            |..||||:|||.:|..:.:|.:     .||:..|  ||.|...|::....|.:
  Fly   257 GKACGFQSLLVLSGCLTKEDML-----NAPVEAQ--PDYYADSLADFTQLLEN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32487NP_728791.1 PGP_euk 30..311 CDD:273635 81/291 (28%)
Hydrolase_6 34..134 CDD:290083 28/105 (27%)
Hydrolase_like 229..>281 CDD:289983 20/54 (37%)
CG2680NP_570021.2 HAD-SF-IIA 25..270 CDD:273637 71/254 (28%)
Hydrolase_6 25..126 CDD:290083 28/103 (27%)
Hydrolase_like 220..295 CDD:289983 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.