DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and Y27F2A.10

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001122653.1 Gene:Y27F2A.10 / 6418638 WormBaseID:WBGene00045303 Length:254 Species:Caenorhabditis elegans


Alignment Length:270 Identity:53/270 - (19%)
Similarity:97/270 - (35%) Gaps:89/270 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LLTGLARCDTVLIITSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTV 214
            |.|.|::..|::|.:|                         |:......|..:|:    :..|..
 Worm     6 LCTELSKLQTMIIASS-------------------------FVQIECLTICFVAK----HQIFAK 41

  Fly   215 TLERYVAVCHPLKARALCTYGRAK---IYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCV 276
            .|.|::.      :|....:|.|.   :..||.:..|.| |:.:.::.:...|||       :..
 Worm    42 LLNRHIV------SRISYYFGAAGFTCVPIIVVIAISQA-NVYQEYQHIETCYPE-------YLA 92

  Fly   277 RPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCL---------------IYRQVK--RANR 324
            |...|  |:..|..:..|||.          ||:|.|:               :::.:|  :...
 Worm    93 RFKNL--SDFAIYTFNEWCYF----------LAVLACMEALFCVTVAVITTWDMFKMLKALQLRV 145

  Fly   325 ERQRLSRSEKREIGL-----ATMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHKITKISNLLITI 384
            .:.:|.|.:...|.|     |::||.|..|..:...|   .|.|      .:..|.:::.|:...
 Worm   146 SKIQLQRYKSAIISLVSQMAASLLLLVAFVCLLATVL---TNFS------ANQAIAELALLIGAQ 201

  Fly   385 NSSVNFLIYI 394
            :|.||.::.|
 Worm   202 HSIVNVIVLI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 52/268 (19%)
7tm_1 130..393 CDD:278431 52/267 (19%)
Y27F2A.10NP_001122653.1 7TM_GPCR_Srh <15..221 CDD:299815 50/261 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.