DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and CNMaR

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster


Alignment Length:450 Identity:99/450 - (22%)
Similarity:169/450 - (37%) Gaps:166/450 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RIEFWVCGVL----INIVGVLGILGNIISMIILSRPQMRS-SINYLLTGLARCDTVL---IITSI 166
            ||.|::...:    |.::...|.:|||:|:.:..|.::|. |.::.|..||..||..   :....
  Fly    52 RIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLAGLFAQW 116

  Fly   167 LLFGIPSIY--PYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKAR 229
            |.|....||  .|...||.:::|              :|...|::.....|:||::||.:|||.:
  Fly   117 LNFLNVDIYNQNYFCQFFTFFSY--------------LASFCSVWFVVAFTVERFIAVIYPLKRQ 167

  Fly   230 ALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCV------RPSRLRRSETYI 288
            .:||..|||   ||..|.:|.                    ..|||:      :|..:.:..|.|
  Fly   168 TMCTVRRAK---IVLFCLTLV--------------------GCLHCLPYIVIAKPVFMPKLNTTI 209

  Fly   289 -----------NIYIHWCYLIVNYIIPFLTLAILN----CLIYR--------------------- 317
                       .::.:|..::| |.:||.|:|:||    |.:::                     
  Fly   210 CDLNSEYKEQLALFNYWDTIVV-YAVPFTTIAVLNTCTGCTVWKFATVRRTLTMHKMKPQTNSMP 273

  Fly   318 ---------------------QVKR--------------ANR---ERQRLSRSEKREIG------ 338
                                 .:||              |||   ::::..:|::.:|.      
  Fly   274 SNSSNSSGGASSAVASYRLSASLKRQKSTGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHC 338

  Fly   339 ------------------LATMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHK-------ITKIS 378
                              :..|||.|..||..|| ||..|...||::.|...:       :..|.
  Fly   339 EITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLN-LPSCLLRIEAYWETESARNQNSTIALQYIF 402

  Fly   379 NLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSRDQPDLIHYESSIS----NNGDGT 434
            :.....|..:||::|.:.|:.|::..|.||  ||:|..|.:..:.:.::|    |.|..|
  Fly   403 HAFFITNFGINFVLYCVSGQNFRKAVLSIF--RRVSSAQREAGNTQVTVSEYCRNTGTST 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 81/388 (21%)
7tm_1 130..393 CDD:278431 80/379 (21%)
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 56/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46641
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.