DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and OR52K1

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001005171.2 Gene:OR52K1 / 390036 HGNCID:15222 Length:314 Species:Homo sapiens


Alignment Length:348 Identity:76/348 - (21%)
Similarity:141/348 - (40%) Gaps:94/348 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PLLENNRIEFWVCGVLINIVGVLGILGNIISMIILSRPQMRSSINYL-LTGLARCDTVLIITSIL 167
            |.||:  :..|: .:.......|.:|||...:.|:..........|| |..||..|  |:::|..
Human    20 PGLEH--LHAWI-SIPFCFAYTLALLGNCTLLFIIQADAALHEPMYLFLAMLATID--LVLSSTT 79

  Fly   168 LFGIPSIYPYTG---HFFG-----YYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCH 224
            |..:.:|:.:..   :||.     ::.:.:..:..||.          :.|.|    :||||:|.
Human    80 LPKMLAIFWFRDQEINFFACLVQMFFLHSFSIMESAVL----------LAMAF----DRYVAICK 130

  Fly   225 PLKARALCT------YGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHC----VRPS 279
            ||....:.|      .|.|.:...|.:...|.:.:.||...        ...||.||    :...
Human   131 PLHYTTVLTGSLITKIGMAAVARAVTLMTPLPFLLRRFHYC--------RGPVIAHCYCEHMAVV 187

  Fly   280 RLRRSET-YINIY----------IHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSE 333
            ||...:| :.|||          :...::|::|:  |:..|:|                :|:..|
Human   188 RLACGDTSFNNIYGIAVAMFIVVLDLLFVILSYV--FILQAVL----------------QLASQE 234

  Fly   334 KREIGLATMLLCVVIVFFMLN-FLPLVLNISEAFYSTIDHKITKISNLLITINSSVNFLIY---- 393
            .|.....|   ||..:..:|: :.|:|:       |::.|::.:.:...:.|..::.:|::    
Human   235 ARYKAFGT---CVSHIGAILSTYTPVVI-------SSVMHRVARHAAPRVHILLAIFYLLFPPMV 289

  Fly   394 --IIFGEKFKRI--FLLIFFKRR 412
              ||:|.|.|:|  ::|..|:|:
Human   290 NPIIYGVKTKQIREYVLSLFQRK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 63/308 (20%)
7tm_1 130..393 CDD:278431 61/293 (21%)
OR52K1NP_001005171.2 7tm_4 33..312 CDD:304433 71/330 (22%)
7tm_1 43..294 CDD:278431 62/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.