DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and CG15614

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_611168.2 Gene:CG15614 / 36899 FlyBaseID:FBgn0034168 Length:469 Species:Drosophila melanogaster


Alignment Length:332 Identity:67/332 - (20%)
Similarity:133/332 - (40%) Gaps:68/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FWVCGVLINIVGVLGILGNIISMIILSRPQMRSSINYLLTGLA--RCDTVLIITSILLFGIPSIY 175
            |.:.|:.:..:...|:..|.|:.::..||:|..|....|..|:  .|.:.|:||   :..:...|
  Fly    39 FVLYGLAVPTLSAFGLCTNFINAVVFMRPKMTPSAFSYLAALSWMDCISCLLIT---MTALSRSY 100

  Fly   176 PYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAV-CHPLK--ARALCTYGRA 237
            .|:...:..|:|.:.      .|:..|:...:..:...::|:|::.: |....  |...|....|
  Fly   101 FYSSPTWITYDYQWQ------TPLFGISTGGANLILACLSLDRFIYLSCFKRNNGAPRFCRRKVA 159

  Fly   238 KIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSET-------YINIY--IH 293
            :...:|.:..|:..|||.|:    |.|                :..|.|       |.|.|  .:
  Fly   160 RCIIVVAIGISIVVNMPYFF----VFY----------------VSDSGTCHVTEFYYTNFYKVQN 204

  Fly   294 WCYLIVNYIIPFLTLAILN---CLIYR------QVKRANRERQRLSRSEKR---EIGLATMLLCV 346
            |....:..::|.:.|.|.|   .:.:|      ::.:||........:.||   ::.| |:.:.:
  Fly   205 WFTFALLALLPAIFLVIGNGAIIIAFRKWTKQSRICQANNPAANSRTTAKRYQHQMKL-TISIVI 268

  Fly   347 VIVFFMLNFLPLVLNISEAFYSTI---------DHKITKISNLLITINS---SVNFLIYIIFGEK 399
            ||..::...||..:...::..:.:         |..|.::..:.||:|:   |:|.::|.:....
  Fly   269 VITLYLFGELPAHMTSRKSSLNLLFGGDANKVDDSFIEQLEVICITLNALQLSLNIVVYAVINPS 333

  Fly   400 FKRIFLL 406
            |...|.|
  Fly   334 FMPEFFL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 61/309 (20%)
7tm_1 130..393 CDD:278431 60/300 (20%)
CG15614NP_611168.2 7tm_4 48..>242 CDD:304433 44/222 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46641
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.