DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and Olr74

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001000134.1 Gene:Olr74 / 293218 RGDID:1332815 Length:314 Species:Rattus norvegicus


Alignment Length:332 Identity:68/332 - (20%)
Similarity:134/332 - (40%) Gaps:82/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PLLENNRIEFWV----CGVLINIVGVLGILGNIISMIILSRPQMRSSINYL-LTGLARCDTVLII 163
            |.|||  .:|||    |     ::.|:.:.|||..:.|:..........|| |..||..|  |::
  Rat    20 PGLEN--YQFWVAFPFC-----VMYVVAVTGNITILHIIRIDHTLHEPMYLFLAMLATTD--LVL 75

  Fly   164 TSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIY--MTFTVTLERYVAVCHPL 226
            :|.....:.:|..:..|...|        :..:..:..|...:|:.  :...:.|:||||:|.||
  Rat    76 SSSTQPKMLAILWFHDHEIEY--------NACLIQVFFIHAFSSVESGVLMAMALDRYVAICFPL 132

  Fly   227 KARALCT------YGRA----KIYFIVCVCFSLAYNMPRFW--EVLTVTYPEPGKDVILHCVRPS 279
            :..::.|      .|.|    .:.::...||.:: .|| |.  :|:..:|.|....:.|.|    
  Rat   133 RHSSILTTSVVIKLGAAVMVRGLLWVSPFCFMIS-RMP-FCPNKVIPQSYCEHMAVLKLVC---- 191

  Fly   280 RLRRSETYIN----IYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREIGLA 340
                ::|.:|    :::  .:.:|.:.|  :.:::...:|.|.|.|......||     :..|..
  Rat   192 ----ADTRVNRGYGLFV--AFSVVGFDI--IVISVSYVMILRAVLRLPSGEARL-----KAFGTC 243

  Fly   341 TMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHKI---------TKISNLLITINSSVNFLIYIIF 396
            ...:.|::..::           .|.::.:.|:.         ...:|:.:.:...:|.:||   
  Rat   244 ASHIGVILTLYI-----------PALFTFLTHRFGHHVPRVVHIMFANVYLLVPPMLNPIIY--- 294

  Fly   397 GEKFKRI 403
            |.:.|:|
  Rat   295 GVRTKQI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 56/299 (19%)
7tm_1 130..393 CDD:278431 54/290 (19%)
Olr74NP_001000134.1 7tm_4 33..312 CDD:304433 61/317 (19%)
7tm_1 43..294 CDD:278431 54/290 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.