DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and Olfr584

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_667265.1 Gene:Olfr584 / 259056 MGIID:3030418 Length:319 Species:Mus musculus


Alignment Length:330 Identity:71/330 - (21%)
Similarity:135/330 - (40%) Gaps:78/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PLLENNRIEFWV----CGVLINIVGVLGILGNIISMIILSRPQMRSSINYL-LTGLARCDTVLII 163
            |.|||  .:|||    |     ::.::.:.|||..:.|:..........|| |..||..|  |::
Mouse    25 PGLEN--YQFWVAFPFC-----VMYIVAVTGNITILHIIRIDHTLHEPMYLFLAMLATTD--LVL 80

  Fly   164 TSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLK- 227
            :|.....:.:|..:..|...|:..:.     .||.|...:...| .:..|:.|:||||:|.||: 
Mouse    81 SSSTQPKMLAILWFHDHKIEYHACLI-----QVFFIHAFSSVES-GVLMTMALDRYVAICFPLRH 139

  Fly   228 ARALCTYGRAKIYFIVCV---------CFSLAYNMPRFW--EVLTVTYPEPGKDVILHCVRPSRL 281
            :..|.|....|:..:|.|         ||.:: .|| |.  :::..:|.|....:.|.|      
Mouse   140 SSILTTSAVIKLGAVVMVRGLLWVSPFCFMVS-RMP-FCPNKIIPQSYCEHMAVLKLVC------ 196

  Fly   282 RRSETYIN----IYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREIGLATM 342
              ::|.:|    :::  .:.:|.:.|  :.:::...:|.|.|.|......||     :..|....
Mouse   197 --ADTRVNRGYGLFV--AFSVVGFDI--IVISVSYVMILRAVLRLPSGEARL-----KAFGTCAS 250

  Fly   343 LLCVVIVFFMLNFLPLVLNISEAFYSTIDHKI---------TKISNLLITINSSVNFLIYIIFGE 398
            .:.|::..::           .|.::.:.|:.         ...:|:.:.:...:|.:||   |.
Mouse   251 HIGVILTLYI-----------PALFTFLTHRFGHHVPRVVHIMFANVYLLVPPMLNPIIY---GV 301

  Fly   399 KFKRI 403
            :.|:|
Mouse   302 RTKQI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 59/297 (20%)
7tm_1 130..393 CDD:278431 58/288 (20%)
Olfr584NP_667265.1 7tm_4 38..317 CDD:304433 64/315 (20%)
7tm_1 48..299 CDD:278431 58/288 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.