DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and Olfr1179

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_667128.2 Gene:Olfr1179 / 258919 MGIID:3031013 Length:307 Species:Mus musculus


Alignment Length:346 Identity:79/346 - (22%)
Similarity:123/346 - (35%) Gaps:109/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NNRIEFWVCGV--------------LINIVGVLGILGNIISMIILSRPQ-----MRSSINYL-LT 152
            ||..||.:.|:              |...:.:||  ||:|.:|.::..|     |...:||| |:
Mouse     5 NNITEFILLGLSQNKKIKALCFLMFLFCYIAILG--GNMIILISITCSQLIEQPMYFFLNYLALS 67

  Fly   153 GLARCDTVL--IITSILLFGIPSIYP------YTGHFFGYYNYVYPFISPAVFPIGMIAQTASIY 209
            .|....||.  .:|.:|:......|.      :|.||||              .|.::..|...|
Mouse    68 DLCYTSTVTPKFLTDLLVERNKISYTSCMAQLFTMHFFG--------------GIEILILTVMAY 118

  Fly   210 MTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKD---- 270
                   :||||:|.||....:.:.||.  :.:|..|.:.|:.......:|.::.|..|.:    
Mouse   119 -------DRYVAICKPLHYSIIMSRGRC--HAMVTACCAGAFIHSFLQSLLAISLPFCGHNEMDH 174

  Fly   271 --------VILHC----------VRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYR 317
                    :.|.|          |..|.:....|:  :.:.|.|..:.|.|              
Mouse   175 YFCDIYPLLTLSCTNTHRVGLLVVANSGMMGLVTF--VVLMWSYYFILYTI-------------- 223

  Fly   318 QVKRANRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLP-LVLNISEAFYSTIDHKITKISNLL 381
                      |...:|.|...|:|....|.:|.|.  |:| |.:.|..|.....|    |:..|.
Mouse   224 ----------RAYPAESRSKALSTCSSHVTVVIFF--FVPVLFIYIRPATTYPED----KVFALF 272

  Fly   382 ITINSSV-NFLIYIIFGEKFK 401
            .||.:.: |.|||.:...:.|
Mouse   273 YTILAPMFNPLIYTLRNTEMK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 71/309 (23%)
7tm_1 130..393 CDD:278431 68/300 (23%)
Olfr1179NP_667128.2 7tm_4 29..303 CDD:304433 74/322 (23%)
7tm_1 39..285 CDD:278431 68/300 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.