DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and sri-43

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_494458.1 Gene:sri-43 / 191916 WormBaseID:WBGene00005555 Length:325 Species:Caenorhabditis elegans


Alignment Length:216 Identity:43/216 - (19%)
Similarity:70/216 - (32%) Gaps:69/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 YFIVCVCFSLAYNMPRFWEVLTVTYPEPGKD--------------------------------VI 272
            ||.|...||.|.|:.   .:|.|.|.....|                                :.
 Worm    12 YFYVIGVFSFALNLA---VILLVIYKSESIDNFKYYILAFQVFCMLADFHISLLVQPMYLFQFMT 73

  Fly   273 LHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREI 337
            ..||.|:.......|:.|..| ..|.:.|::.||..|              |..|.:::.::..:
 Worm    74 YSCVGPAATYMWANYLLITTH-LLLGIQYVLLFLCFA--------------RRHQAIAKIKQHHV 123

  Fly   338 --------GLATMLLCVVIVFFMLNFLPLVLNISEAFYSTI--DHK--ITKISNLLITINSSVNF 390
                    .:|..|.|.|.......:..:.....|.|...:  |||  :..:.|.:|...::|..
 Worm   124 IPEILFNSFIAFELACPVAACICYFYTGVEQEKVEGFIDQMYPDHKTELLSLQNYVIYRENTVYM 188

  Fly   391 LIYIIF----GEKFKRIFLLI 407
            :.::||    |   ..:||||
 Worm   189 IFFVIFKMLAG---SLVFLLI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 36/197 (18%)
7tm_1 130..393 CDD:278431 36/196 (18%)
sri-43NP_494458.1 7TM_GPCR_Sri 2..300 CDD:287317 43/216 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.