Sequence 1: | NP_001261347.1 | Gene: | FMRFaR / 38357 | FlyBaseID: | FBgn0035385 | Length: | 549 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494458.1 | Gene: | sri-43 / 191916 | WormBaseID: | WBGene00005555 | Length: | 325 | Species: | Caenorhabditis elegans |
Alignment Length: | 216 | Identity: | 43/216 - (19%) |
---|---|---|---|
Similarity: | 70/216 - (32%) | Gaps: | 69/216 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 YFIVCVCFSLAYNMPRFWEVLTVTYPEPGKD--------------------------------VI 272
Fly 273 LHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREI 337
Fly 338 --------GLATMLLCVVIVFFMLNFLPLVLNISEAFYSTI--DHK--ITKISNLLITINSSVNF 390
Fly 391 LIYIIF----GEKFKRIFLLI 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FMRFaR | NP_001261347.1 | 7tm_4 | 122..394 | CDD:304433 | 36/197 (18%) |
7tm_1 | 130..393 | CDD:278431 | 36/196 (18%) | ||
sri-43 | NP_494458.1 | 7TM_GPCR_Sri | 2..300 | CDD:287317 | 43/216 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |