DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and sri-31

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_494434.1 Gene:sri-31 / 191906 WormBaseID:WBGene00005543 Length:324 Species:Caenorhabditis elegans


Alignment Length:315 Identity:69/315 - (21%)
Similarity:141/315 - (44%) Gaps:50/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IVGVLGILGN--IISMIILSRPQMRSSINYLLTGLARC-----DTVLIITSILLFGIPSIYPYTG 179
            |.|.:.|..|  :|.:|:....::.:...|||.....|     :...:...|.||.|.:.|.: |
 Worm    19 ISGTIAICLNLLVIYLILFHSGKLDNFRFYLLAFQIWCTASDVNIAFLFQPIFLFQILAGYGH-G 82

  Fly   180 HFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVC 244
            .|:.::::. .|...|:|.:.:..|...:.:.|   ..::.|:   :|.|.........|.:::|
 Worm    83 WFYDWFDFT-SFTCFAIFTLLLSGQIEVLTICF---FRKHHAI---MKLRPTTDKVPYPIIYVLC 140

  Fly   245 VCFSLAYNMPRF---------WEVLTVTYPEPGKDVILHCVRP--SRLRRSETYINIYIHWCYLI 298
            :|:|:...:..:         |:::.:.||.         :.|  .|||........|.....|:
 Worm   141 MCYSIVITLSCYSIRISKEEQWQLIQLNYPS---------MVPQFQRLREFSIVRMTYELITLLV 196

  Fly   299 VNYIIPFLTLAILNCLIYRQVKRANRERQRLSRS--EKREIGLATMLLCVVIVFFM--LNFLP-- 357
            :|.:..|.|..:::.|::|........:.:|||:  .|.:|.|.    |:|:.|..  ::|||  
 Worm   197 LNAVGTFKTTLVISVLVFRMYNVLFLMQSQLSRTTLAKHKIALK----CLVLQFMTTPISFLPAF 257

  Fly   358 -LVLNISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411
             |:||:  ||.:....:|:..|.::.|.:|:.|.|:.:....:|::  .::|:|:
 Worm   258 VLLLNV--AFPTPYSQEISNFSLMVATTHSTANCLVVMTTYPEFRK--TVMFWKK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 66/296 (22%)
7tm_1 130..393 CDD:278431 63/287 (22%)
sri-31NP_494434.1 7TM_GPCR_Sri 5..303 CDD:287317 67/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.