DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and T02D1.4

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_503104.2 Gene:T02D1.4 / 187984 WormBaseID:WBGene00011371 Length:446 Species:Caenorhabditis elegans


Alignment Length:400 Identity:92/400 - (23%)
Similarity:170/400 - (42%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 CEDVYNPLLENNRIEFWVCGVLINIVGVLGILGNIISMIILSRPQMRSSINYLLTGLARCDTVLI 162
            |:.:.| |.||.::..|:.|.....|.:|.:.||:::::|.:    ...|.|.:.....|..:|:
 Worm    73 CDRIAN-LCENRQLYTWLVGYGFIFVFLLALFGNVVNLLIYN----SDHIKYYIAIRMLCTRLLM 132

  Fly   163 ITSILLFGIP------SIYPYTGH----FFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLE 217
            .:..|:..:|      |.:....|    ::.||.|...|::...|        .::::|..:|.|
 Worm   133 NSLTLICMLPQALRIVSAWDSDSHINEIYWVYYPYQIYFVNLFGF--------CAMWLTVLMTAE 189

  Fly   218 RYVAVCHPLKARALCT-YGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVR--PS 279
            .|:.|..|..:::||| ...::.|||:.|..:|...|.:|...:|::         .||.|  |:
 Worm   190 CYLHVFFPSHSKSLCTKRNLSRSYFIILVVGALLALMYKFNRSVTLS---------THCNRVIPT 245

  Fly   280 RLRRSETYINIYIHWCYLIVN----YIIP-----FLTLAILNCLIYRQ---VKRANRERQRLSRS 332
             :..||.::.|.:...:...|    .::|     |:..:||..|:.::   |.....|::.::|.
 Worm   246 -IHASEDFVMICLEKIHTFANLLFAIVVPMGLLLFMAASILWKLVLKRSDFVSHFTAEKRCVTRI 309

  Fly   333 EKREIGLATM--LLCVVIVFFMLNFLPLVLN-ISEAFYSTIDHKITKISNLLITINSSVNFLIYI 394
            .....||..:  |..:.:..:...|.|.|.| .:...::|       |:..|...|.|::|.:|:
 Worm   310 TLITTGLQLIAELPPIPVFLYATIFGPAVTNEPAICVWNT-------IAVFLGLCNVSLSFFVYL 367

  Fly   395 IFGEKFKRIFLLIFFKRRLSRDQP------DLIHYESSISNNGDGTLNHRSSGRFSRHGTQRST- 452
            :|.:||:.:     .|.||....|      .|:||.   :.:.|..|......|...|..|..| 
 Worm   368 VFSDKFREM-----VKTRLCELIPCISSPRSLVHYS---NESTDPKLRTNLLAREQVHIKQPETE 424

  Fly   453 ----TTTYLV 458
                |.|||:
 Worm   425 SSVCTETYLL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 64/299 (21%)
7tm_1 130..393 CDD:278431 62/290 (21%)
T02D1.4NP_503104.2 7tmA_FMRFamide_R-like 88..377 CDD:320109 70/322 (22%)
TM helix 1 90..114 CDD:320109 6/27 (22%)
TM helix 2 122..145 CDD:320109 4/22 (18%)
TM helix 3 166..188 CDD:320109 4/29 (14%)
TM helix 4 211..227 CDD:320109 5/15 (33%)
TM helix 5 259..282 CDD:320109 3/22 (14%)
TM helix 6 304..329 CDD:320109 4/24 (17%)
TM helix 7 345..370 CDD:320109 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46641
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.