DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and sri-66

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_507321.2 Gene:sri-66 / 185043 WormBaseID:WBGene00005578 Length:327 Species:Caenorhabditis elegans


Alignment Length:336 Identity:68/336 - (20%)
Similarity:121/336 - (36%) Gaps:107/336 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LLFGIPSIYPYTGHFF-----GYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPL 226
            |:|.:.:||..   ||     |.:.|..           :|.|.||:....::|....:...:||
 Worm    24 LVFNLLAIYLL---FFEINDLGTFRYNL-----------LIFQMASLLTDLSITTLSTIVPLYPL 74

  Fly   227 KARALCTYGRAKIYFIVC--VCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYIN 289
              .|:.|:|....:|.|.  .||..:........|           .:|.|.. .:.:...|.|:
 Worm    75 --NAVTTFGILSTWFGVSSHFCFVFSGGCSHLENV-----------TLLLCFF-KKHQAIATIID 125

  Fly   290 IYI------HWCYLIVNYI--IPFLTLAILNC-----LIYRQVKR-------ANRERQRLSRSEK 334
            :::      ..|||:|..:  ||.:.|::|:.     |||..:..       |:.|:..:.|...
 Worm   126 VHVVPKFLGFACYLLVLVLASIPLVGLSLLSVSRDEQLIYINMTSPEYYSSFASLEQFAVWRESW 190

  Fly   335 REIGLATMLLCV------VIVFFMLNFLPLVLN----------------ISEAFYSTIDHKI--- 374
            ..:|:..:.||.      ::|||.|:.:.:::.                |...|..|:...|   
 Worm   191 ALLGVYIIALCEMSTLAGLLVFFNLDLVRMMVKLRSKVSNLNFQKHREAIQSLFIQTLVSLICST 255

  Fly   375 ----------TKISNLLI---------TINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSRDQPDL 420
                      ||:.|..|         ..:|.||.:..:||...::|     |.::...|....|
 Worm   256 SPCILGFSVMTKMENAQIISELCLLGFACHSPVNVISLLIFSPPYRR-----FLEKLFRRGNRQL 315

  Fly   421 I---HYESSIS 428
            |   |.:|.::
 Worm   316 IVHPHSQSGVN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 59/297 (20%)
7tm_1 130..393 CDD:278431 59/296 (20%)
sri-66NP_507321.2 7TM_GPCR_Sri 2..304 CDD:287317 62/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.