DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and sri-57

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_494328.2 Gene:sri-57 / 184844 WormBaseID:WBGene00005569 Length:330 Species:Caenorhabditis elegans


Alignment Length:338 Identity:59/338 - (17%)
Similarity:122/338 - (36%) Gaps:41/338 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IEFWVCGVLINIVGVLGILGNIIS--MIILSRPQMRSSINYLLTGLARCDTVLIITSILLFGIPS 173
            :.||:...|..| |.:.:|.:..|  :::....|:.:...:||.....|.......:.|:..:| 
 Worm     6 VPFWLIYYLHGI-GTISLLFDAFSVYLVMFKSSQIDNFRFFLLNFQIACSVTDFHITFLMQPVP- 68

  Fly   174 IYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYV------AVCHPLK----A 228
            :||..|      .|...|: |..|.:       |::...|..:..|:      .||...|    |
 Worm    69 LYPLMG------GYALGFL-PMKFGV-------SLHSCLTAVVFLYIYQVASMIVCFVRKNQSIA 119

  Fly   229 RALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIH 293
            ..|.::....:..|..|.|...|..............|..|...:....|..|...::..|..|:
 Worm   120 GTLTSFAIPALLIIFLVGFLAVYTFSVVGMYFCSGITENEKMKFVEENLPEYLSSFQSLPNFSIY 184

  Fly   294 ------WCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREIGLATMLLCVVIVFFM 352
                  :..:|...|...|..:....::|...:..:..:.::|.:..:....|...|.......:
 Worm   185 QANALLFIMVITAVIGGLLAFSFFMAVLYNIFRMLSFMKVQMSDTTYKRHRAAVWSLIAQFATSI 249

  Fly   353 LNFLPLVLNISEAFYSTIDHKITKISNLLITI---NSSVNFLIYIIFGEKFKRIFLLIFFKRRLS 414
            :.|||.:..:...|....:.::  |..||:.:   :|..|..:.:.....:::...:..|:::.:
 Worm   250 ICFLPPISLVFVVFLKLPNPQV--IVELLLVVACLHSPANVTVLMFTFPPYRKFVCVTIFRQKPT 312

  Fly   415 RDQPDLIHYESSI 427
            ..:|  |..:||:
 Worm   313 GLEP--ISAKSSV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 51/292 (17%)
7tm_1 130..393 CDD:278431 48/283 (17%)
sri-57NP_494328.2 7TM_GPCR_Sri 2..302 CDD:287317 54/313 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.