DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FMRFaR and s1pr2

DIOPT Version :9

Sequence 1:NP_001261347.1 Gene:FMRFaR / 38357 FlyBaseID:FBgn0035385 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001153442.1 Gene:s1pr2 / 170457 ZFINID:ZDB-GENE-020123-2 Length:370 Species:Danio rerio


Alignment Length:324 Identity:69/324 - (21%)
Similarity:125/324 - (38%) Gaps:95/324 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 VCGVLINIVGVLGILGNIISMIILSR-PQMRSSINYLLTGLARCDTV---LIITSILLFGIPSIY 175
            :|.::        ||.|::.:|.:.| .:..|::.:.:..||..|.:   ..|.:|.|.|     
Zfish    63 ICSII--------ILENLLVLIAVFRNKKFHSAMFFFIGNLAFSDLLAGSAYIANIFLSG----- 114

  Fly   176 PYTGHFFGYYNYVYPFISPAVFPI----GMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGR 236
            |.|.|           ::|..:.|    ..||.:||::....:.:|||:|:   .|.:...:...
Zfish   115 PRTFH-----------LTPVQWFIREGTAFIALSASVFSLLAIAIERYIAI---TKVKVYGSNKT 165

  Fly   237 AKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVI-----LHCVRPSRLRRSETYINIYIHWCY 296
            .:::.::..|:.::        :|....|..|.:.|     ...|.|...|       .||.:..
Zfish   166 CRMFLLIGACWVMS--------ILLGGLPIIGWNCINNLDDCSAVLPLNTR-------YYIRFVV 215

  Fly   297 LIVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREIGLATMLLCVVIVF--FMLNFLPL- 358
            .|.:.|:  |::.||...||..|        |.|..|........:|..|.||.  |::.:||. 
Zfish   216 TIFSIIL--LSIVILYVRIYLIV--------RTSHQEATNSPAYALLKTVTIVLGVFIICWLPAF 270

  Fly   359 ---------------VLNISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLI 407
                           :||.:..|:|            ..|:||::|.|||.:..:..::.||.:
Zfish   271 TILLLDTSCKMKQCPILNNAGIFFS------------FATLNSALNPLIYTLRSKDMRKEFLRV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FMRFaRNP_001261347.1 7tm_4 122..394 CDD:304433 65/302 (22%)
7tm_1 130..393 CDD:278431 62/293 (21%)
s1pr2NP_001153442.1 7tm_1 70..308 CDD:278431 62/293 (21%)
7tm_4 71..323 CDD:304433 66/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.