DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and AT4G33640

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001329390.1 Gene:AT4G33640 / 829505 AraportID:AT4G33640 Length:161 Species:Arabidopsis thaliana


Alignment Length:153 Identity:46/153 - (30%)
Similarity:59/153 - (38%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ESQE--SPQDSSVSSRITLFNQQAEQHKNWMMINPFAHYNVNEMPKRTFPEEEYGRAPTGSLSEQ 65
            ||.|  |.:...|||.|..|                  ||:..:......|||            
plant    31 ESIELSSSETERVSSSIQSF------------------YNIRLLRPEISKEEE------------ 65

  Fly    66 RSLQANVRALEEILQLCDLIQKSGRDDPIDGRKVLAFGQLF--ETYNNISDKLLATLLGARKYGF 128
               :.||.  |||.:|.:.|.:.| ....||...:.||.||  :...||.:.|:.||..|:|...
plant    66 ---RMNVD--EEIQKLEEEIHRLG-SRQTDGSYKVTFGVLFNDDRCANIFEALVGTLRAAKKRKI 124

  Fly   129 VDFSGETLFQGRDDTEPVRLLRP 151
            |.|.||.|.||..|...: .|||
plant   125 VAFEGELLLQGVHDKVEI-TLRP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 27/74 (36%)
AT4G33640NP_001329390.1 Costars 68..144 CDD:405405 29/79 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107581
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.