DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and Abracl

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001346488.1 Gene:Abracl / 73112 MGIID:1920362 Length:81 Species:Mus musculus


Alignment Length:75 Identity:25/75 - (33%)
Similarity:40/75 - (53%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EILQLCDLIQKSGRDDPIDGRKVLAFGQLFETYN--NISDKLLATLLGARKYGFVDFSGETLFQG 139
            |:..|.:.|.:.|..: .||:..:.||.||:...  |:.:.|:.||..|::...|.::||.|.||
Mouse     6 EVNLLVEEIHRLGSRN-ADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYAGELLLQG 69

  Fly   140 -RDDTEPVRL 148
             .||.:.|.|
Mouse    70 VHDDVDIVLL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 24/73 (33%)
AbraclNP_001346488.1 Costars 2..78 CDD:317149 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107581
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.