powered by:
Protein Alignment CG2113 and Abracl
DIOPT Version :9
Sequence 1: | NP_647757.2 |
Gene: | CG2113 / 38356 |
FlyBaseID: | FBgn0035384 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001346488.1 |
Gene: | Abracl / 73112 |
MGIID: | 1920362 |
Length: | 81 |
Species: | Mus musculus |
Alignment Length: | 75 |
Identity: | 25/75 - (33%) |
Similarity: | 40/75 - (53%) |
Gaps: | 4/75 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 EILQLCDLIQKSGRDDPIDGRKVLAFGQLFETYN--NISDKLLATLLGARKYGFVDFSGETLFQG 139
|:..|.:.|.:.|..: .||:..:.||.||:... |:.:.|:.||..|::...|.::||.|.||
Mouse 6 EVNLLVEEIHRLGSRN-ADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYAGELLLQG 69
Fly 140 -RDDTEPVRL 148
.||.:.|.|
Mouse 70 VHDDVDIVLL 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3376 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_107581 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.710 |
|
Return to query results.
Submit another query.