DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and abrab

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001003986.1 Gene:abrab / 445477 ZFINID:ZDB-GENE-040822-7 Length:359 Species:Danio rerio


Alignment Length:146 Identity:51/146 - (34%)
Similarity:78/146 - (53%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SPQDSSVSSRITLFNQQAEQHKNWMMINPFAH---YNVNEMPKRTFPEEEYGRAPTGSLSEQRSL 68
            |.:.|:|.:..:.:...|.:|.....:|||:.   |..:...:....||.|||...||.:.:|:.
Zfish   214 SKKYSTVGNLKSRWQNWASEHTINQKLNPFSEDFDYEYSMSTRLHKGEEGYGRPKEGSKTAERAK 278

  Fly    69 QANVRALEEILQLCDLIQKSGRDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKYGFVDFSG 133
            :|......||..:|.:|:.....|| ||...:.||:||:.|..||||::..|:.|||:|.|.|.|
Zfish   279 RAEKHIHREIDDMCFVIRTMADPDP-DGYTRVTFGELFDRYVRISDKVVGILMRARKHGKVAFEG 342

  Fly   134 ETLFQGRDDTEPVRLL 149
            |.|:||:||...:.||
Zfish   343 EMLWQGQDDDVIITLL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 31/72 (43%)
abrabNP_001003986.1 Costars 283..357 CDD:291377 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm6516
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.