DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and abraa

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_699540.2 Gene:abraa / 324520 ZFINID:ZDB-GENE-120730-1 Length:346 Species:Danio rerio


Alignment Length:132 Identity:46/132 - (34%)
Similarity:70/132 - (53%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AEQHKNWMMINPFA------HYNVNEMPKRTFPEEEYGRAPTGSLSEQRSLQANVRALEEILQLC 82
            ||.|.....:|||:      |.....:.|   .:..|||...||.:.||:.:|......|:.::|
Zfish   218 AEDHMEGQKLNPFSEEFDYDHAMATRLHK---GDAGYGRPKEGSKTAQRADRAQKHIYREMEEMC 279

  Fly    83 DLIQKSGRDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKYGFVDFSGETLFQGRDDTEPVR 147
            .:|:..|:.|. .|:..:.||:||:.|..||||::..||..||:..|||.||.|::|:||...:.
Zfish   280 FIIRDMGQQDK-QGQIWVTFGRLFDRYVKISDKVVGILLRCRKHKMVDFEGEMLWKGQDDDVIIT 343

  Fly   148 LL 149
            ||
Zfish   344 LL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 28/72 (39%)
abraaXP_699540.2 Costars 270..344 CDD:291377 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm6516
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.