DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and Abra

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_787038.1 Gene:Abra / 286965 RGDID:708493 Length:375 Species:Rattus norvegicus


Alignment Length:133 Identity:48/133 - (36%)
Similarity:76/133 - (57%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FNQQAEQHKNWMMINPFA---HYNVNEMPKRTFPEEEYGRAPTGSLSEQRSLQANVRALEEILQL 81
            :.|.|::|.....:|||:   .|::....:....:|.|||...||.:.:|:.:|......||::|
  Rat   243 WQQWADEHIQSQKLNPFSDEFDYDLAMSTRLHKGDEGYGRPKEGSKTAERAKRAEEHIYREIMEL 307

  Fly    82 CDLIQKSGRDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKYGFVDFSGETLFQGRDDTEPV 146
            |.:|:...|... ||:..:.||:||:.|..||||::..|:.|||:|.|.|.||.|:||:||...:
  Rat   308 CFVIRTMARHRR-DGKIQVTFGELFDRYVRISDKVVGILMRARKHGLVHFEGEMLWQGKDDHVVI 371

  Fly   147 RLL 149
            .||
  Rat   372 TLL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 31/72 (43%)
AbraNP_787038.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..197
Actin-binding 1 193..293 13/49 (27%)
Interaction with actin. /evidence=ECO:0000250|UniProtKB:Q8BUZ1 234..279 7/35 (20%)
Actin-binding 2 294..375 34/82 (41%)
Costars 299..373 CDD:291377 31/74 (42%)
Interaction with actin. /evidence=ECO:0000250|UniProtKB:Q8BUZ1 346..375 15/29 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - otm44479
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.